PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01302.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 439aa    MW: 47211.4 Da    PI: 6.4073
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01302.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-39121180261
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  Rsa1.0_01302.1_g00008.1 121 PDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKNP 180
                              7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-32117178IPR003851Zinc finger, Dof-type
PfamPF027018.5E-32123179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.64125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MSDPAIKLFG KTIPLPELVG GDLTEQQDQN PVRLSDSCTG DDEEMGDSGL AGGGDGGGDS  60
ESHKEEKYAE CGEESLCNES SNVGAAASSI TEKTETTKAA KTDEESSQNG TCSQEAKLKK  120
PDKILPCPRC NSMETKFCYY NNYNVNQPRH FCKKCQRYWT AGGTMRNVPV GAGRRKNKNP  180
ASHYNRHVTI TSAEAMQKAA RTADNGTSLL TFGSDSVLCE SMASGLNLAD KSLLKKTQTG  240
SQEGLKITVP LNPSKEAGTV SPLPCFPGPP PPTWPYAWNG VSWTAVPFYP PPAYWSYPGV  300
SPGTWNSITW MPQPTSPSGG GSGPNSPTLG KHSREESVAE PGTAVEETES HGREKSKPER  360
CLWVPKTLRI DDPEEAAKSS IWETLGIKKD EKADTFGAFR SPNKEKSSLS SQGKLAGRRP  420
ELQANPAALS RSANFHESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013743159.10.0PREDICTED: cyclic dof factor 2-like
SwissprotQ93ZL50.0CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A0D2ZPT10.0A0A0D2ZPT1_BRAOL; Uncharacterized protein
STRINGBra025655.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137951825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.20.0cycling DOF factor 2